| Transcript | Ll_transcript_351946 |
|---|---|
| CDS coordinates | 3-302 (+) |
| Peptide sequence | MVDVENPIIIDREYCPWNQCSKQTPSKVKISKVSFKNIKGTSATKEAVKLICSKSIPCQGVELSEINLTFKGAPAIAVCSNVTPKIIGKAPACTAAASA* |
| ORF Type | complete |
| Blastp | Polygalacturonase from Medicago with 61.05% of identity |
|---|---|
| Blastx | Polygalacturonase from Medicago with 61.36% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019459851.1) |
| Pfam | Glycosyl hydrolases family 28 (PF00295.16) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer