Protein coding transcript 56533

• Transcript: Ll_transcript_363980
• CDS coordinates: 494-1153 (+)
• Peptide sequence: MRKRPAPTAAMEVVPPAEPRYRGVRKRPWGRFAAEIRDPIKKARVWLGTFDSAEEAARAYDAAAVSLRGPKAKTNFPINPSPFYNHHANNPYFDHHRYYATAAGNNGGGGGFNDHGVINPHRPASSGMSSTVESFSGPRPPSAVPPPPITRRYPRTPPLVAEDCHSDCDSSSSVVDDGDDIASSSFKAPLPFDLNVLPLDIDAEVANGDDEIHRTALCL*
• ORF Type: complete

Annotations of Ll_transcript_363980

• Blastp: Ethylene-responsive transcription factor 7 from Arabidopsis with 56.9% of identity
• Blastx: Ethylene-responsive transcription factor 7 from Arabidopsis with 55.07% of identity
• Eggnog: ethylene mediated signaling pathway(ENOG410YQNQ)
• Kegg: Link to kegg annotations (AT3G20310)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435641.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;