Protein coding transcript 56608

• Transcript: Ll_transcript_362843
• CDS coordinates: 546-1085 (+)
• Peptide sequence: MLQKHQRQSSLVKVWESISQGLQIYPFSPDLLKGVVEVGHLHTTSNKLRWMVDDLCYKKPSVLLWLFALCYEMSRGGTQHRIRGLFEKALSNDRLCSSVVLWRCYIAYELDIAHDASAARRIFFRAIHSCPWSKRLWLDGFLKLNSVLNAKELSDLHEVMVDKELNLRTDIYEILLQES*
• ORF Type: complete

Annotations of Ll_transcript_362843

• Blastp: Protein NRDE2 homolog from Mus with 27.93% of identity
• Blastx: Protein NRDE2 homolog from Mus with 27.93% of identity
• Eggnog: nrde-2 necessary for RNA interference, domain containing(ENOG410XPGD)
• Kegg: Link to kegg annotations (217827)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430339.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;