Transcript | Ll_transcript_361866 |
---|---|
CDS coordinates | 2492-3058 (+) |
Peptide sequence | MSMRLLHIWLRYESLSVLQFNTINLKRARILVKSHVLHSTVPGCKDCNREENILTWPQFMKPEIIFGLPLEKMNIERSHFMVKAFLKLYAHEKYILMVNQQQQDLRFHVSFKVGATSVSVLRSVWQSFWLSENWNREGNVCDQLGNSLMELENKFEDFIQKLKVAEWDTQKLNLKVPKEILIDDINPL* |
ORF Type | complete |
Blastp | Protein root UVB sensitive 5 from Arabidopsis with 56.15% of identity |
---|---|
Blastx | Protein root UVB sensitive 5 from Arabidopsis with 56.44% of identity |
Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
Kegg | Link to kegg annotations (AT5G01510) |
CantataDB | Link to cantataDB annotations (CNT0001676) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462270.1) |
Pfam | - |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer