Transcript | Ll_transcript_361851 |
---|---|
CDS coordinates | 159-752 (+) |
Peptide sequence | MSQILQLSFSSTSTGLSSSVKMKGTAKRPFFFQILCSSSKHSSFKDEDDDNVNKGDRGLSRVILVERYSNGTAKRYVVDDDSQLQTFLFEEDKSTTNMLQDSQRLSWLPEIIKDFILPAGFPGSVSDDYLNYMLLQFPTNVTGWICHTLVTSSLLKAVGVGSFSGSTAAASAAAIRWVSKDGIGAVGRLFIGGRFGNL |
ORF Type | 3prime_partial |
Blastp | Protein root UVB sensitive 5 from Arabidopsis with 66.21% of identity |
---|---|
Blastx | Protein root UVB sensitive 5 from Arabidopsis with 61.38% of identity |
Eggnog | Chromosome 16 open reading frame 58(ENOG410XU74) |
Kegg | Link to kegg annotations (AT5G01510) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019462270.1) |
Pfam | Vitamin B6 photo-protection and homoeostasis (PF04884.13) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer