Transcript | Ll_transcript_362480 |
---|---|
CDS coordinates | 502-846 (+) |
Peptide sequence | MGFAKFKGCFVLVFFVGFLVGSVSGIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADSDILEALKKSGIQVMVGIPNDMLYTLANSLQAAEKWVSKNISAHLSSGGVDIR* |
ORF Type | complete |
Blastp | Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 64.6% of identity |
---|---|
Blastx | Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 78.53% of identity |
Eggnog | glucan endo-1,3-beta-glucosidase(ENOG410YE7X) |
Kegg | Link to kegg annotations (AT4G31140) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447498.1) |
Pfam | Glycosyl hydrolases family 17 (PF00332.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer