Protein coding transcript 56670

• Transcript: Ll_transcript_362482
• CDS coordinates: 502-1422 (+)
• Peptide sequence: MGFAKFKGCFVLVFFVGFLVGSVSGIGVNWGTQSTHPLPPSTVVKMLKDNGIQKVKLFDADSDILEALKKSGIQVMVGIPNDMLYTLANSLQAAEKWVSKNISAHLSSGGVDIRYIAVGNEPFLSTYNGTFESTTLPALQNIQSALIKSGLGNQVKVTVPMNADVYLSASDKPSDGDFRPDIHDLMLQIVKFLSQNNAPFTVNIYPFISLYSDANFPVDFAFFDGFQTPINDNGRIYDNVLDANHDTLVWALQKNGFGNMPIIVGEIGWPTDGDHNANIKYAQRFNQGFMSRLLAGKGTPIRPGPID
• ORF Type: 3prime_partial

Annotations of Ll_transcript_362482

• Blastp: Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 73.2% of identity
• Blastx: Glucan endo-1,3-beta-glucosidase 5 from Arabidopsis with 75.99% of identity
• Eggnog: glucan endo-1,3-beta-glucosidase(ENOG410YE7X)
• Kegg: Link to kegg annotations (AT4G31140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019457796.1)
• Pfam: Glycosyl hydrolases family 17 (PF00332.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;