Protein coding transcript 567

• Transcript: Ll_transcript_520349
• CDS coordinates: 1-333 (+)
• Peptide sequence: LIWADGCSIYDYSIFGDVLAFDATYGRNKYKFPVVLFSGVNHHKQTTVFCAAVVSNETEETYVWILEKFLEAMNGKQPKCVITDGDLAMKNAILRVFPEAHHRLCAWHICN
• ORF Type: internal

Annotations of Ll_transcript_520349

• Blastp: Protein FAR1-RELATED SEQUENCE 5 from Arabidopsis with 44.95% of identity
• Blastx: Protein FAR1-RELATED SEQUENCE 5 from Arabidopsis with 44.95% of identity
• Eggnog: protein FAR1-RELATED SEQUENCE 5-like(ENOG410ZJSX)
• Kegg: Link to kegg annotations (AT4G38180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416721.1)
• Pfam: MULE transposase domain (PF10551.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;