Transcript | Ll_transcript_362000 |
---|---|
CDS coordinates | 137-436 (+) |
Peptide sequence | MDPMDIVGKSKEDASLPKATMTKIIKEMLPPDVRVARDTQDILIECCVEFINLLSSESNEVCGRDERRTIAPEHVLKALGVIINDYISSFNVDTFQFIF* |
ORF Type | complete |
Blastp | Protein Dr1 homolog from Arabidopsis with 74% of identity |
---|---|
Blastx | Protein Dr1 homolog from Arabidopsis with 82.95% of identity |
Eggnog | Down-regulator of transcription 1, TBP-binding (Negative cofactor 2)(COG5150) |
Kegg | Link to kegg annotations (AT5G23090) |
CantataDB | Link to cantataDB annotations (CNT0002891) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019417431.1) |
Pfam | Histone-like transcription factor (CBF/NF-Y) and archaeal histone (PF00808.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer