Protein coding transcript 56772

• Transcript: Ll_transcript_362317
• CDS coordinates: 260-745 (+)
• Peptide sequence: MDQEGGGSNGGSCYYSVLGIHRNASSSDIRTAYRKLAMKWHPDKFARNPATVGEAKRRFQQIQEAYSVLSDESKRLTYDAGLYDPLEEDNQDFCDFMQEMISMMNNVKDEGDSLEDLQRMFMDIVGGDDMNFELNQDRTAGKRGRVGGSNGNAPKRTNSCC*
• ORF Type: complete

Annotations of Ll_transcript_362317

• Blastp: DnaJ homolog subfamily B member 6 from Silurana with 62.12% of identity
• Blastx: GATA transcription factor 15 from Arabidopsis with 47.66% of identity
• Eggnog: ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins (By similarity)(COG0484)
• Kegg: Link to kegg annotations (394712)
• CantataDB: Link to cantataDB annotations (CNT0001526)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419637.1)
• Pfam: DnaJ domain (PF00226.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;