Protein coding transcript 56929

• Transcript: Ll_transcript_363709
• CDS coordinates: 465-1010 (+)
• Peptide sequence: METGESNTSNARGIISENSPWFSQFRNACNPWMARYAYALIFLVANLLAWAARDYGRTALTEMERLKGCDGGKDCLGAEGVLRVSLGCFIFYIIMFLSTAGTSKLNQARDRWHSGWWPVKIVLWVAMTVIPFLLPSALIQIYGDVAHFGAGVFLLIQLISIISFITWLHNCCESEKYATRW*
• ORF Type: complete

Annotations of Ll_transcript_363709

• Blastp: Probable serine incorporator from Dictyostelium with 25.71% of identity
• Blastx: Serine incorporator 1 from Pongo with 35.14% of identity
• Eggnog: serine incorporator(ENOG410XP7K)
• Kegg: Link to kegg annotations (DDB_G0281099)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424389.1)
• Pfam: Serine incorporator (Serinc) (PF03348.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;