Protein coding transcript 56996

• Transcript: Ll_transcript_363614
• CDS coordinates: 82-411 (+)
• Peptide sequence: MNLVSGYKGVVGFVFGNENSPNADSYVERLLDRISNGKLEEDRRNAITELQAVVSESQASQLSMGATGFPIMLSILKKERDDVEMVTELPSLCLLVYLFLLFVGQGCGS*
• ORF Type: complete

Annotations of Ll_transcript_363614

• Blastp: Golgin candidate 6 from Arabidopsis with 65.12% of identity
• Blastx: Golgin candidate 6 from Arabidopsis with 65.12% of identity
• Eggnog: USO1 vesicle docking protein homolog (yeast)(ENOG410XRCG)
• Kegg: Link to kegg annotations (AT3G27530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439685.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;