Transcript | Ll_transcript_363629 |
---|---|
CDS coordinates | 82-639 (+) |
Peptide sequence | MNLVSGYKGVVGFVFGNENSPNADSYVERLLDRISNGKLEEDRRNAITELQAVVSESQASQLSMGATGFPIMLSILKKERDDVEMVRGALETLVSALTPINHAKVSSNEVHPASMNADLLSREAESIPLLLSLLDEDDFYVRYYTLQLLTALVTNSPQRLQEAILTVPRGITRLMDMLMDREGGI* |
ORF Type | complete |
Blastp | Golgin candidate 6 from Arabidopsis with 71.43% of identity |
---|---|
Blastx | Golgin candidate 6 from Arabidopsis with 74.69% of identity |
Eggnog | USO1 vesicle docking protein homolog (yeast)(ENOG410XRCG) |
Kegg | Link to kegg annotations (AT3G27530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439687.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer