Protein coding transcript 56998

• Transcript: Ll_transcript_363629
• CDS coordinates: 82-639 (+)
• Peptide sequence: MNLVSGYKGVVGFVFGNENSPNADSYVERLLDRISNGKLEEDRRNAITELQAVVSESQASQLSMGATGFPIMLSILKKERDDVEMVRGALETLVSALTPINHAKVSSNEVHPASMNADLLSREAESIPLLLSLLDEDDFYVRYYTLQLLTALVTNSPQRLQEAILTVPRGITRLMDMLMDREGGI*
• ORF Type: complete

Annotations of Ll_transcript_363629

• Blastp: Golgin candidate 6 from Arabidopsis with 71.43% of identity
• Blastx: Golgin candidate 6 from Arabidopsis with 74.69% of identity
• Eggnog: USO1 vesicle docking protein homolog (yeast)(ENOG410XRCG)
• Kegg: Link to kegg annotations (AT3G27530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439687.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;