Protein coding transcript 570

• Transcript: Ll_transcript_520328
• CDS coordinates: 2-958 (+)
• Peptide sequence: MGCVGICGSDIHYYAHGRCAEFVVKQPMVIGHEGSGTVAKVGKNVKNVKPGDKVAIEPGVPCRRCEFCVKGEYNLCPGIFFCATPPDNGNLCQYYTHDADFCHKLPDNMSLEEGALMEPLSVGVHACNQANIKFGDHVLITGCGPIGLVSLLAAKAMGATKVIMTDIVDHRMKVALKAGADAVVDVSKGTVEEQVGQIKKLLGGDLAKVTLDCSGFETSMRLAIHGTRPGGTIVLVGMGCSGDMTLPLSAALCKEITIKGVFRYRNCYPTAIAMVSSGKVNVKQFITHNFNLDQSLEAFDTARHGKGNPVKVMIHCSK*
• ORF Type: complete

Annotations of Ll_transcript_520328

• Blastp: Sorbitol dehydrogenase from Bos with 55.38% of identity
• Blastx: Sorbitol dehydrogenase from Bos with 55.38% of identity
• Eggnog: Dehydrogenase(COG1063)
• Kegg: Link to kegg annotations (508954)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (NP_001239661.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;