Transcript | Ll_transcript_363362 |
---|---|
CDS coordinates | 166-993 (+) |
Peptide sequence | MASAAIEGLNGKFTMRGCDTPLIVRFADPIKPKTGESRDKYLPGNANFGPSSQEPAAWPQPNFGNSNIGRSIPPTGPHHPPIPHPQVTSQMQNWERGAAVVQHPFPFQQVHSQMVSMPLQPIQAPNVSSQPFSTEVQRQSHLVDSTAQNMEQKLNSQLHTQTGSNSDKVVDSIQPIVPINFPDEVFPDCDWSEHYCPDGHKYYYNCVTCESRWEKPEENVLCEKESQKPQGQEDHSGLRSQLASSSPQQVAQSHQDINNDLKQTETSNVEQVKEE* |
ORF Type | complete |
Blastp | Flowering time control protein FCA from Arabidopsis with 54.55% of identity |
---|---|
Blastx | Flowering time control protein FCA from Arabidopsis with 51.49% of identity |
Eggnog | CUGBP, Elav-like family member(ENOG410XNTW) |
Kegg | Link to kegg annotations (AT4G16280) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438215.1) |
Pfam | WW domain (PF00397.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer