Protein coding transcript 57141

• Transcript: Ll_transcript_363375
• CDS coordinates: 414-962 (+)
• Peptide sequence: MQNWERGAAVVQHPFPFQQVHSQMVSMPLQPIQAPNVSSQPFSTEVQRQSHLVDSTAQNMEQKLNSQLHTQTGSNSDKVVDSIQPIVPINFPDEVFPDCDWSEHYCPDGHKYYYNCVTCESRWEKPEENVLCEKESQKPQGQEDHSGLRSQLASSSPQQVAQSHQDINNDLKQTETSNVEQV*
• ORF Type: complete

Annotations of Ll_transcript_363375

• Blastp: Flowering time control protein FCA from Arabidopsis with 61.11% of identity
• Blastx: Flowering time control protein FCA from Arabidopsis with 49.06% of identity
• Eggnog: CUGBP, Elav-like family member(ENOG410XNTW)
• Kegg: Link to kegg annotations (AT4G16280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438215.1)
• Pfam: WW domain (PF00397.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;