Protein coding transcript 5717

• Transcript: Ll_transcript_471104
• CDS coordinates: 1306-1767 (+)
• Peptide sequence: MLSKDIGEGIKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFSLKPGTHLQQPIPKSWNAFVYVLEGEGVFGNPKSHPTNSHHILLLGSGDGLEAWNKSSKQLRFILVGGEPLGEPVVQFGPFVMNTQEEIDQTIDDFDNYANGFEKARHWNSE*
• ORF Type: complete

Annotations of Ll_transcript_471104

• Blastp: Pirin-like protein At1g50590 from Arabidopsis with 67.95% of identity
• Blastx: Pirin-like protein At1g50590 from Arabidopsis with 67.88% of identity
• Eggnog: pirin domain protein(COG1741)
• Kegg: Link to kegg annotations (AT1G50590)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460983.1)
• Pfam: Pirin C-terminal cupin domain (PF05726.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;