Transcript | Ll_transcript_471105 |
---|---|
CDS coordinates | 1188-1649 (+) |
Peptide sequence | MLSKDIGEGIKDGIKVRVIAGEALGVKSPIYTRTPTMYLDFSLKPGTHLQQPIPKSWNAFVYVLEGEGVFGNPKSHPTNSHHILLLGSGDGLEAWNKSSKQLRFILVGGEPLGEPVVQFGPFVMNTQEEIDQTIDDFDNYANGFEKARHWNSE* |
ORF Type | complete |
Blastp | Pirin-like protein At1g50590 from Arabidopsis with 67.95% of identity |
---|---|
Blastx | Pirin-like protein At1g50590 from Arabidopsis with 67.88% of identity |
Eggnog | pirin domain protein(COG1741) |
Kegg | Link to kegg annotations (AT1G50590) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460983.1) |
Pfam | Pirin C-terminal cupin domain (PF05726.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer