Protein coding transcript 57180

• Transcript: Ll_transcript_338720
• CDS coordinates: 3-386 (+)
• Peptide sequence: HMNSNLPVLCTDSSKMLGITLDQAVFNSASALYYDAKFMHWIVDQVPDQSLLNTAGWRFIIPQLYKKYPNHDMNLNVSLSSPPVVEISNQKAGAHIFADLTIDVLEDDKVIPVACISLVGSLILNYV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_338720

• Blastp: Putative BPI/LBP family protein At1g04970 from Arabidopsis with 69.64% of identity
• Blastx: Putative BPI/LBP family protein At1g04970 from Arabidopsis with 69.64% of identity
• Eggnog: BPI fold containing family B, member(ENOG410Z88E)
• Kegg: Link to kegg annotations (AT1G04970)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462118.1)
• Pfam: LBP / BPI / CETP family, C-terminal domain (PF02886.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;