Protein coding transcript 57206

• Transcript: Ll_transcript_338744
• CDS coordinates: 57-872 (+)
• Peptide sequence: MQAAGALSINIGKRPRDLLNPKAVNYMQSVFSIKDAISKKESREISALFGITVKQVRDFFASQRSRVRRLVQLSRERALISNSCEESHDGQINSDDPMRPINPVPLNSVGPINAEEASCSTQEATLSGLDGLDKQFVDNIFSLMQKEETFSGQEKLMEWILTVQNFVVLLWFLTRGGVMILATWLSTAAIEEQTSVLLLILKVLCHLPLHKAPPAQISAILQSVNRLRFYRTSGVLRYTSPSLGAHQTRHIDLFLMLTPLFVPASLVLYSP*
• ORF Type: complete

Annotations of Ll_transcript_338744

• Blastp: Homeobox protein LUMINIDEPENDENS from Arabidopsis with 48.41% of identity
• Blastx: Homeobox protein LUMINIDEPENDENS from Arabidopsis with 62.08% of identity
• Eggnog: homeobox protein(ENOG4111YQX)
• Kegg: Link to kegg annotations (AT4G02560)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440851.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;