Transcript | Ll_transcript_338749 |
---|---|
CDS coordinates | 217-1200 (+) |
Peptide sequence | MEVSNDDFMEVEIGSSVESLQNFLASQRDLFHSQIDQFQQIVVTQCKLTGVNPLSQEMAAGALSINIGKRPRDLLNPKAVNYMQSVFSIKDAISKKESREISALFGITVKQVRDFFASQRSRVRRLVQLSRERALISNSCEESHDGQINSDDPMRPINPVPLNSVGPINAEEASCSTQEATLSGLDGLDKQFVDNIFSLMQKEETFSGQEKLMEWILTVQNFVVLLWFLTRGGVMILATWLSTAAIEEQTSVLLLILKVLCHLPLHKAPPAQISAILQSVNRLRFYRTSGVLRYTSPSLGAHQTRHIDLFLMLTPLFVPASLVLYSP* |
ORF Type | complete |
Blastp | Homeobox protein LUMINIDEPENDENS from Arabidopsis with 51.75% of identity |
---|---|
Blastx | Homeobox protein LUMINIDEPENDENS from Arabidopsis with 64.36% of identity |
Eggnog | homeobox protein(ENOG4111YQX) |
Kegg | Link to kegg annotations (AT4G02560) |
CantataDB | Link to cantataDB annotations (CNT0001964) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019440851.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer