Protein coding transcript 57257

• Transcript: Ll_transcript_339066
• CDS coordinates: 2-313 (+)
• Peptide sequence: GLDGGMNKLSKTNQPQLSRSRKHRNQCSLIRSYSSLPHLSKTLQPIFQDSVLHIPHHHGAPRDNISLRHFIKQFLRNTNLSVSNQTRQHGVPRDHIPTKGIFIK
• ORF Type: internal

Annotations of Ll_transcript_339066

• Blastp: Pentatricopeptide repeat-containing protein At2g42920, chloroplastic from Arabidopsis with 46.81% of identity
• Blastx: Pentatricopeptide repeat-containing protein At2g42920, chloroplastic from Arabidopsis with 46.81% of identity
• Eggnog: Pentatricopeptide repeat-containing protein(ENOG410Z7Z7)
• Kegg: Link to kegg annotations (AT2G42920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439277.1)
• Pfam: PPR repeat (PF12854.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;