Transcript | Ll_transcript_336593 |
---|---|
CDS coordinates | 340-945 (+) |
Peptide sequence | MARSETHGCGTTLAWPEAHGRSMALAWPKAHDLVLARSETHGRGMTLAWPEAYGRIMALAWPEAHGLVLARSEMHGRGMTLAWPEAHRRSMTLAWPKAYGRSMALAWPKAYGRSMALAWPKAHGTWPESWLGMTRLAWAVVHTRLLGKNELCDYSNTWINLRSILHILFSLDWLFLCKRVDLCISQLFLIIQVIVVWLLSM* |
ORF Type | complete |
Blastp | Circumsporozoite protein from Plasmodium (Plasmodium) with 23.26% of identity |
---|---|
Blastx | Protein FAM186A from Mus with 28.08% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427311.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer