Protein coding transcript 57369

• Transcript: Ll_transcript_339084
• CDS coordinates: 358-1731 (+)
• Peptide sequence: MSKQDMMKIQSCILKVNIHCDGCEQKVKKLLQKIEGVYKVSIDAEQGKVVVSGHVDPIKLIKKLKSSGKHAELWGGNRGMMFNQNFASNPQFKNLQIDNSKGGKDNKTKNNKGSKKGDGGGVQLAHFQNMKGGKDLKVGGKDKKSVKFNLEDEEFDDSDDGFDDDEDEIDDDDDEDEDEEYGHGHAHGMHKKVMPMMGNGGHGPQGPRGMMMNGFAMNNHKGNGFGGNYGGSAKKGDVIDIPIQMKGKGGNGSFNEGKNGNKGGEKKKGGGGGEDSNNKKKKDGKAKSGGGFLVKFLGLGKKSNKGGSMDTTSKNKNNNGNHDGKNKGKESKKGGGGEKLDKVDFGFQDFDITQGKNGKSGKVNNNGHGHHGGNNGNMGQMGPMGQRGGSMEQMRSIPAVQGLPASAAAAMNGGYYQGMQMQMQPNPYNNNLQQLQQQQYMAMMMQQQQQQQANMSVY
• ORF Type: 3prime_partial

Annotations of Ll_transcript_339084

• Blastp: Heavy metal-associated isoprenylated plant protein 32 from Arabidopsis with 66.67% of identity
• Blastx: Heavy metal-associated isoprenylated plant protein 32 from Arabidopsis with 66.33% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT3G06130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441156.1)
• Pfam: Heavy-metal-associated domain (PF00403.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;