| Transcript | Ll_transcript_336816 |
|---|---|
| CDS coordinates | 204-509 (+) |
| Peptide sequence | MKRSICNVFHGLIPAILMVMVQVALAGVSIFFKLAINVGLSVRVATAYRLTFASAFTVPLALISERDLHIRVWKLWFSVQMENPGGEVMAVGYDLSGCRGGG |
| ORF Type | 3prime_partial |
| Blastp | WAT1-related protein At1g68170 from Arabidopsis with 50% of identity |
|---|---|
| Blastx | WAT1-related protein At1g68170 from Arabidopsis with 50% of identity |
| Eggnog | auxin-induced protein 5NG4-like(ENOG410YFQG) |
| Kegg | Link to kegg annotations (AT1G68170) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_003531568.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer