Protein coding transcript 57390

• Transcript: Ll_transcript_336812
• CDS coordinates: 3-446 (+)
• Peptide sequence: LTLSHMVLNPICTYSKLNTIVKMKSICNILDGLKPVMLMVMVQVAFTVVNVLYKLAINDGMSVRVATAYRLAFGSAFTVPLALISERKNRPKLTWRVLFMAFLCGLFGGSLFQNLFYGALALTSATFVSAIYNLIPAITFILAICCG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_336812

• Blastp: WAT1-related protein At3g30340 from Arabidopsis with 45.95% of identity
• Blastx: WAT1-related protein At3g30340 from Arabidopsis with 45.95% of identity
• Eggnog: Auxin-induced protein(ENOG410YEU9)
• Kegg: Link to kegg annotations (AT3G30340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440380.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;