Protein coding transcript 574

• Transcript: Ll_transcript_334357
• CDS coordinates: 3-575 (+)
• Peptide sequence: GGDTRLSFTSYLYAALVRKGITTFRDDKQLEKGDAISQQLHHSIQQSLAAVVVISENYASSTWCLDELKLILESKIDVFPVFYGVTPSDVRYQKNSFADAFKKHVVRFEQDKDKVQKWRDSLKEVADFSGWESKGMAEAELIEEVIEKVWIKLQPKLPSYNEGVVGFDSRVKKMISLSSIGSQDVRFIGIW
• ORF Type: internal

Annotations of Ll_transcript_334357

• Blastp: TMV resistance protein N from Nicotiana with 43.88% of identity
• Blastx: TMV resistance protein N from Nicotiana with 43.88% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019459892.1)
• Pfam: TIR domain (PF01582.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;