Protein coding transcript 5740

• Transcript: Ll_transcript_471029
• CDS coordinates: 2-631 (+)
• Peptide sequence: TIESNMKVSCNGCRILRKGCGDNCVIRPCLEWINSPESQANATMFLAKFYGRTALVNLISAAPEHLRTDVFKSLLHEACGRLVNPTYGSMGLLWSGEWNRCEAAVDAVLNGSRILDVSGFDWHTTGAHVGGAENILPTCDIRHVPRPRDMDNLGERGRSKRARRNFKATPQVGAVDSPENESMETVEQPLNQTISEMELNLELTLAFPG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_471029

• Blastp: LOB domain-containing protein 41 from Arabidopsis with 58.16% of identity
• Blastx: LOB domain-containing protein 41 from Arabidopsis with 58.16% of identity
• Eggnog: lob domain-containing protein(ENOG410YBK4)
• Kegg: Link to kegg annotations (AT3G02550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441393.1)
• Pfam: Lateral organ boundaries (LOB) domain (PF03195.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;