Protein coding transcript 57427

• Transcript: Ll_transcript_337081
• CDS coordinates: 75-383 (+)
• Peptide sequence: MEQGTSKQNSKRTSCATVLTLAYQSLGVVYGDLSTSPLYVYKATFSGKLRLKEDDVEIFGVLSFVFWTLTIIALFKYIFIVMSADDNGEGRILQHGYAVLDY*
• ORF Type: complete

Annotations of Ll_transcript_337081

• Blastp: Potassium transporter 1 from Arabidopsis with 78.89% of identity
• Blastx: Potassium transporter 1 from Arabidopsis with 75.26% of identity
• Eggnog: Transport of potassium into the cell (By similarity)(COG3158)
• Kegg: Link to kegg annotations (AT2G30070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006591235.1)
• Pfam: K+ potassium transporter (PF02705.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;