Transcript | Ll_transcript_337066 |
---|---|
CDS coordinates | 75-1787 (+) |
Peptide sequence | MTSFLSAVSGVKVKISQLHDNYVVMISCVILVGLFSIQHYGTHRVAFMFAPIVAAWLLCISGIGIYNIFHWNPQIFRALSPLYMLRFLKTNGIEGWLSLGGVVLSITGVETMYADLGHFSALSIKIAFTCLVYPCLILAYMGEAAFLSKHHYDIQRSFYKAIPEAVFWPVFIVATFAAIVGSQAVISATFSIISQCCALNCFPPVKIVHTSSRIYGQIYVPEINWILMCLCLAVTIGLRDTNMLGHAYGLAITTVMFVTTCLMTLVTVIVWKQGIIKAVMCFLLFGTIELLYISASICKVPEGGWVPLVLSCLFMGIMFTWNYGTIKKHQFDVENKVSMSRILSLGPRLGMVRVPGIGLIFSNLVSGVPAIFGHFVTNLPAFHQVLVFVCVKSVQVPYVCENERLVISRVGPREYAMFHCVVRYGYKDVQQENYNFEIKLVAAMIQFVQVEDEDVPQVPSHELSIDGENLSVDGLGVSAHTFNMSHCNIDGHDQESLYKYESLKILKAKESGVTYILGHSYAKAKKSSSILKKIAIDLVYAFLSKNCRDPDVVMNLAHTSLLEVGMVYNV* |
ORF Type | complete |
Blastp | Potassium transporter 1 from Arabidopsis with 68.31% of identity |
---|---|
Blastx | Potassium transporter 1 from Arabidopsis with 68.31% of identity |
Eggnog | Transport of potassium into the cell (By similarity)(COG3158) |
Kegg | Link to kegg annotations (AT2G30070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460287.1) |
Pfam | K+ potassium transporter (PF02705.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer