Protein coding transcript 57447

• Transcript: Ll_transcript_338702
• CDS coordinates: 166-855 (+)
• Peptide sequence: MEKANSLGLLRTKSDQLVESIAAAFKSPQSSDHSTNEMVDGAGTMSRKSSRRLIPASPGRGGGKNTHIRKSRSAQISQMKFELDEVSSGAALSRASSASLGLSFSFTGFAMPPDEIADSKPFSDDDIPEDIEAGIKTKFQMETTLPIYLKFTDVTYKVVVKGMASSVEKDILNGISGSVSPGEVLALMGPSGSGKTTLLNLLGGRLSQPSIGGSVTYNDLAYSKSLKSK*
• ORF Type: complete

Annotations of Ll_transcript_338702

• Blastp: ABC transporter G family member 22 from Arabidopsis with 71.3% of identity
• Blastx: ABC transporter G family member 22 from Arabidopsis with 70% of identity
• Eggnog: (ABC) transporter(COG1131)
• Kegg: Link to kegg annotations (AT5G06530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428047.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;