Transcript | Ll_transcript_338708 |
---|---|
CDS coordinates | 121-555 (+) |
Peptide sequence | MNDLLRVSMEKANSLGLLRTKSDQLVESIAAAFKSPQSSDHSTNEMVDGAGTMSRKSSRRLIPASPGRGGGKNTHIRKSRSAQISQMKFELDEVSSGAALSRASSASLGLSFSFTGFAMPPDEIADSKPFSDDDIRKFHISLIS* |
ORF Type | complete |
Blastp | ABC transporter G family member 22 from Arabidopsis with 63.24% of identity |
---|---|
Blastx | ABC transporter G family member 22 from Arabidopsis with 63.24% of identity |
Eggnog | (ABC) transporter(COG1131) |
Kegg | Link to kegg annotations (AT5G06530) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019428047.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer