Protein coding transcript 575

• Transcript: Ll_transcript_334335
• CDS coordinates: 3-647 (+)
• Peptide sequence: KGKESDSYMSPKRSEKLVVKSTTKVVQQNVEVSVVSSTKRATRGNKDTLIGEDVDTLKQEKVRAIPIQEVPPKPKENGQETSEDSGVQNEAEKGVKKVKRGRTKNENDGGKEKRKKKRGRKNGEGYQRYVYRVLKQVHPDLGISSQTMTILNNLMNDMFERLADEAAKLNTCSGHVTLSSREIQGAVKLVLPGELGKHAIAEGAKAVTNYISYV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_334335

• Blastp: Histone H2B from Aspergillus with 60.2% of identity
• Blastx: Histone H2B.2 from Arabidopsis with 63.64% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AN3469.2)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447796.1)
• Pfam: Core histone H2A/H2B/H3/H4 (PF00125.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;