Protein coding transcript 5750

• Transcript: Ll_transcript_471120
• CDS coordinates: 183-842 (+)
• Peptide sequence: MESWESLTAGSAQLLKGASIYLVGNSTEINYKVAQEIATGLGYTPLSTKELLETYSNQTVDSWLLAEGSDSVAEAESAILESISSHVRAAVATLGGQHGASGRPDKWRHLYAGFTVWLSQTEATDEDSAKEETRKNVKDGRLAYTNADVVVKLQGWDSAYAKNVAQACLSALKQLILSDKKLPGKKSLYIRLGCRGDWPNIKPPGWDPSSEGDRSLGTQ*
• ORF Type: complete

Annotations of Ll_transcript_471120

• Blastp: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 75.83% of identity
• Blastx: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 75.64% of identity
• Eggnog: Shikimate kinase(ENOG410XSXA)
• Kegg: Link to kegg annotations (AT2G35500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421268.1)
• Pfam: Shikimate kinase (PF01202.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;