Protein coding transcript 5751

• Transcript: Ll_transcript_471121
• CDS coordinates: 44-664 (+)
• Peptide sequence: MASTTSWAGLWFLTRNTTFSTTNTNTSLEFSVLKPNAGSFRLFSPYSLFHNGSTSLTQRSCKCSYSAPVSTRTYEFSDTSSEVELRLNLKGLDIKSSKEILVDTSDSSLAIRALRPGLPVTLIETNRLFDRIKPSETIWYIDDDELVVNFKKQDPDLKWPDIMESWESLTAGSAQLLKGASIYLVGNSTEINYKVAQEIATGLGYY*
• ORF Type: complete

Annotations of Ll_transcript_471121

• Blastp: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 63.7% of identity
• Blastx: Probable inactive shikimate kinase like 2, chloroplastic from Arabidopsis with 57.14% of identity
• Eggnog: Shikimate kinase(ENOG410XSXA)
• Kegg: Link to kegg annotations (AT2G35500)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450710.1)
• Pfam: CS domain (PF04969.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;