Protein coding transcript 57530

• Transcript: Ll_transcript_337849
• CDS coordinates: 173-862 (+)
• Peptide sequence: MAPKRGVKAPAVAKKKTETVTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQLQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKTVEAKKPIVVKYGLNHVTYLIEQNKAQLVVIAHDVDPIELVVWLPALCRKMEIPYCIVKGKARLGTVVHKKTASVLCLTTVKNEDKLEFSRVLEAIKVGLNLIYSVRFFAV*
• ORF Type: complete

Annotations of Ll_transcript_337849

• Blastp: AP-5 complex subunit beta-1 from Silurana with 28.9% of identity
• Blastx: 60S ribosomal protein L7a-2 from Oryza sativa with 87.96% of identity
• Eggnog: endosomal transport(ENOG410YCX3)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454257.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;