Protein coding transcript 57532

• Transcript: Ll_transcript_337876
• CDS coordinates: 717-1028 (+)
• Peptide sequence: MSSAATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKPVEAKKPIVVKYGLNHVTYLIEQNKAQLVMIAHDVDPIELVVWLPALCRKMEIPYCIVKGKARLGT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_337876

• Blastp: 60S ribosomal protein L7a-2 from Arabidopsis with 90.91% of identity
• Blastx: 60S ribosomal protein L7a-2 from Arabidopsis with 90% of identity
• Eggnog: (ribosomal) protein(COG1358)
• Kegg: Link to kegg annotations (AT3G62870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020222713.1)
• Pfam: Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;