| Transcript | Ll_transcript_337862 |
|---|---|
| CDS coordinates | 98-559 (+) |
| Peptide sequence | MAPKRGVKAPVAAAKKKPVAEKTNPLFEKRPKQFGIGGALPPKRDLTRFVKWPKTVQIQRKKRILKQRLKVPPALNQFTKTLDKNLATSLFKILLKYRPEDKAEKKERLLKRAQAEADGKTVEAKKPIVVKYGLNHVTYLIEQVGFSFIVLCL* |
| ORF Type | complete |
| Blastp | AP-5 complex subunit beta-1 from Silurana with 28.9% of identity |
|---|---|
| Blastx | 60S ribosomal protein L7a-2 from Oryza sativa with 85.38% of identity |
| Eggnog | endosomal transport(ENOG410YCX3) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019454257.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer