Protein coding transcript 57568

• Transcript: Ll_transcript_338897
• CDS coordinates: 752-1618 (+)
• Peptide sequence: MSCKGHSAVLLKDRILILKKGSKPDDQIWFLEFDTQYVRQLQKNLGTEVVAWSKGVTGNAEKPIVISGPSGVGKGTLISMLMKEFPTMFGFSVSHTTRSPRNMEKDGVHYHFTEKCLMEKEIEDGKFLEFASVHGNLYGTSVEAVEVVADAGKRCILDIDVQGARSVRASSLEAVFIFICPPSMEDLENRLRGRGTETEEQVLKRLRNAEAEIKEGKSYKIFDFILYNDNLEECYERLKKLLGLDGFVAAAPKSEPREIILPMDHSLSKKDDKIIINCIPSDKDSKNL*
• ORF Type: complete

Annotations of Ll_transcript_338897

• Blastp: Guanylate kinase 2 from Arabidopsis with 73.45% of identity
• Blastx: Guanylate kinase 2 from Arabidopsis with 69.43% of identity
• Eggnog: Essential for recycling GMP and indirectly, cGMP (By similarity)(COG0194)
• Kegg: Link to kegg annotations (AT3G57550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444086.1)
• Pfam: Guanylate kinase (PF00625.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;