Transcript | Ll_transcript_339016 |
---|---|
CDS coordinates | 289-1041 (+) |
Peptide sequence | MSPFLSTSRALRSLGKSGVTQSIRYNKSGFRYSTTTHQIQTRFFASRIGSSQFMGGYCNNINNYNDCNYNYNYVQTRQFLGCGDGEEGVLTRSYEERIVLGYTPEQLFDVVAAVDFYHGFVPWCQRSEIIKHFPDGSFDAELEIGFKFLVESYVSHVELERPKRIKTTVSQSNLFDHLINIWEFSPGPVPGTCNLYFLVDFKFQSPLYRQIASMFFKEVASRMVGSFTERCRLIYGPEVRVHEKSYGEMK* |
ORF Type | complete |
Blastp | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Pongo with 42.48% of identity |
---|---|
Blastx | Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Pongo with 42.48% of identity |
Eggnog | Cyclase dehydrase(COG2867) |
Kegg | Link to kegg annotations (100172009) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437957.1) |
Pfam | Polyketide cyclase / dehydrase and lipid transport (PF03364.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer