Protein coding transcript 57578

• Transcript: Ll_transcript_339016
• CDS coordinates: 289-1041 (+)
• Peptide sequence: MSPFLSTSRALRSLGKSGVTQSIRYNKSGFRYSTTTHQIQTRFFASRIGSSQFMGGYCNNINNYNDCNYNYNYVQTRQFLGCGDGEEGVLTRSYEERIVLGYTPEQLFDVVAAVDFYHGFVPWCQRSEIIKHFPDGSFDAELEIGFKFLVESYVSHVELERPKRIKTTVSQSNLFDHLINIWEFSPGPVPGTCNLYFLVDFKFQSPLYRQIASMFFKEVASRMVGSFTERCRLIYGPEVRVHEKSYGEMK*
• ORF Type: complete

Annotations of Ll_transcript_339016

• Blastp: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Pongo with 42.48% of identity
• Blastx: Coenzyme Q-binding protein COQ10 homolog B, mitochondrial from Pongo with 42.48% of identity
• Eggnog: Cyclase dehydrase(COG2867)
• Kegg: Link to kegg annotations (100172009)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437957.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF03364.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;