Protein coding transcript 576

• Transcript: Ll_transcript_334359
• CDS coordinates: 57-530 (+)
• Peptide sequence: MGPNALFSSILSIFFLATVASASTFLSDNIFNKSGVSHGRALVEDDEPLKECIIDFEQQNYTVLTSKCKRPNYSPKMCCEAFKQFACPFAEYINDMTTDCAPAMFYFINLHGHYPQGLFADNCKEGPEGLDCTAIKPVTVKISHSSISHGKRPHKKY*
• ORF Type: complete

Annotations of Ll_transcript_334359

• Blastp: GPI-anchored protein LLG2 from Arabidopsis with 57.66% of identity
• Blastx: GPI-anchored protein LLG2 from Arabidopsis with 56.52% of identity
• Eggnog: (GPI)-anchored protein(ENOG410YIWK)
• Kegg: Link to kegg annotations (AT4G28280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451179.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;