Protein coding transcript 57640

• Transcript: Ll_transcript_338953
• CDS coordinates: 157-1290 (+)
• Peptide sequence: MDHNHNHNHNHNHPYHAQWRSIRPFQDSCPTCSFSHFPFCPLPQQPPPPPPPPYYHHHPRLPPHPYPVTNPNYPNLGGGDGGRNSNKRLRIEEEEEEENERRRLKLIRDHGVALPHLNLNSSYHHLPSRSSNGFHSILDPSSSFFIAPPPLPSQPQPPPPPPPPPPSHSSHFNPTSSPLPPPPPPPSSSYSQSRAYFHANPSPPSQFHTPNQHFQQQHSKHHYSPDAPQSFSLNKLLPQKPKFMDASQLFRHPHRTSRPDHIVIILRGLPGSGKSYLAKMLRDIEVENGVDAPRIHSLDDYFMTEVEKVDENDASKSSKSGRNKKPATKKVMEYCYEPEMEEAYRSSMLKSFKKTVEEGVFTFIIGMHHKSMTAKFS*
• ORF Type: complete

Annotations of Ll_transcript_338953

• Blastp: YLP motif-containing protein 1 from Rattus with 51.54% of identity
• Blastx: YLP motif-containing protein 1 from Mus with 53.54% of identity
• Eggnog: YLP motif containing 1(ENOG410YIR5)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451155.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;