Protein coding transcript 57680

• Transcript: Ll_transcript_338109
• CDS coordinates: 998-1363 (+)
• Peptide sequence: MMTPNLNLEPENNSEECSQEASNISLQETPYDLNHTKESTTSSSCLTNLTNAASMTLDLTLNFNSNDAKFKGTSDTSTNIGAEALAPATETPRVFSCNYCRRKFFSSQALGGHQNAHKRERT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_338109

• Blastp: Zinc finger protein 7 from Arabidopsis with 96.77% of identity
• Blastx: Zinc finger protein 7 from Arabidopsis with 96.77% of identity
• Eggnog: Zinc finger protein(ENOG410YNPP)
• Kegg: Link to kegg annotations (AT1G24625)
• CantataDB: Link to cantataDB annotations (CNT0001964)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448359.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;