Protein coding transcript 57682

• Transcript: Ll_transcript_338100
• CDS coordinates: 1709-2074 (+)
• Peptide sequence: MMTPNLNLEPENNSEECSQEASNISLQETPYDLNHTKESTTSSSCLTNLTNAASMTLDLTLNFNSNDAKFKGTSDTSTNIGAEALAPATETPRVFSCNYCRRKFFSSQALGGHQNAHKRERT
• ORF Type: 3prime_partial

Annotations of Ll_transcript_338100

• Blastp: Zinc finger protein 7 from Arabidopsis with 96.77% of identity
• Blastx: Probable carboxylesterase 18 from Arabidopsis with 49.08% of identity
• Eggnog: Zinc finger protein(ENOG410YNPP)
• Kegg: Link to kegg annotations (AT1G24625)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414544.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;