Transcript | Ll_transcript_338104 |
---|---|
CDS coordinates | 583-948 (+) |
Peptide sequence | MMTPNLNLEPENNSEECSQEASNISLQETPYDLNHTKESTTSSSCLTNLTNAASMTLDLTLNFNSNDAKFKGTSDTSTNIGAEALAPATETPRVFSCNYCRRKFFSSQALGGHQNAHKRERT |
ORF Type | 3prime_partial |
Blastp | Zinc finger protein 7 from Arabidopsis with 96.77% of identity |
---|---|
Blastx | Zinc finger protein 7 from Arabidopsis with 96.77% of identity |
Eggnog | Zinc finger protein(ENOG410YNPP) |
Kegg | Link to kegg annotations (AT1G24625) |
CantataDB | Link to cantataDB annotations (CNT0001964) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448359.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer