Protein coding transcript 578

• Transcript: Ll_transcript_520122
• CDS coordinates: 2-364 (+)
• Peptide sequence: NSTPTMSCRSWCICFTICTLITILPIIFIEIFSPSNVEFHVTETSLTQFNLTNNNTMYFNFKVNITARNPNKNTIVYYRRITAIAWYKDNDFAYVSLTPFDQGKKNTSLLQTAVFQGSSVI
• ORF Type: internal

Annotations of Ll_transcript_520122

• Blastp: NDR1/HIN1-like protein 10 from Arabidopsis with 43.12% of identity
• Blastx: NDR1/HIN1-like protein 10 from Arabidopsis with 43.82% of identity
• Eggnog: harpin-induced protein 1 domain containing protein, expressed(ENOG410YGQV)
• Kegg: Link to kegg annotations (AT2G35980)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430466.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;