Protein coding transcript 57807

• Transcript: Ll_transcript_339129
• CDS coordinates: 265-1101 (+)
• Peptide sequence: MMMSLCFCSVTPIHIKYNNNNTLSSSLSLTTPSSFPSSSISSSRSILPMIVRAKTVKEEEEEEEEEDRIHIHNPIPPLNIMISGAPASGKGTQCQLITQKYGLVHVAAGDLLRAEISTGSPNGKLAKEYMEKGELVPDHIVVSMVKDRLNQPDSIRNGWLLDGYPRSLSQATALHQFGFQPHLFILLHVSEDILVDRVVGRRLDPLTGNIYHLQYSPPETQEIAARLTQRFDDTEQKVKLRLNTHHQNVEAVLSLYKDITVQVSMLLLLSNDWTRQLT*
• ORF Type: complete

Annotations of Ll_transcript_339129

• Blastp: Adenylate kinase 2, chloroplastic from Arabidopsis with 75.94% of identity
• Blastx: Adenylate kinase 2, chloroplastic from Arabidopsis with 75.69% of identity
• Eggnog: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolism (By similarity)(COG0563)
• Kegg: Link to kegg annotations (AT5G47840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412833.1)
• Pfam: Adenylate kinase (PF00406.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;