Protein coding transcript 57814

• Transcript: Ll_transcript_339234
• CDS coordinates: 2-421 (+)
• Peptide sequence: ISSQLRLHKAVNFYSLPLQDFTPVAGRYDVIWIQWCICHLTDDDFISFFNRAKVGLKPGGLFILKENIAKTGFVLDNEDKTITRSESYFQSLFSRCGLHIYKSKVQEGFPEGLFAVKMYALTTDILLFAVKMYALTTDIL
• ORF Type: internal

Annotations of Ll_transcript_339234

• Blastp: Alpha N-terminal protein methyltransferase 1 from Arabidopsis with 67.48% of identity
• Blastx: Alpha N-terminal protein methyltransferase 1 from Arabidopsis with 67.48% of identity
• Eggnog: o-methyltransferase(ENOG410XS7T)
• Kegg: Link to kegg annotations (AT5G44450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447684.1)
• Pfam: AdoMet dependent proline di-methyltransferase (PF05891.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;