Protein coding transcript 57823

• Transcript: Ll_transcript_339247
• CDS coordinates: 371-1714 (+)
• Peptide sequence: MELWGIGVDLERCIQARKLLVKRLRYLENEAYKLAGIKFSLSMPADIAKVLFEHLKLPIPDGRNKGKQHPSTDKHCLDALRHEHPIVPVIKEHRTLAKLLNATLGSICSLARLSVSTQKYTLHGHWLQTSTATGRLSMEEPNLQCVEHAVEFKMNEDKNGGDTDDSCCTINARDFFVPTQDNWLLLTADYSQIELRLMAHFSKDPSLIELLSKPDGDVFTMIASRWIGCPEASVGSHDRDLTKKMVYGILYGMGPNSLAEQLDCTSDEAAEKIRNFKRTFPGVASWLLEAVASCRNKGYVETLKGRKRFLSKIKLGNSTEKSKAQRQAVNSICQGSAADIIKIAMLRIYSVIVTGVDSTDSDSSVATKFSMLKDHCRILLQVHDELVLEVHPSMIKEAAMLLQTCMETAISLLVPLQVKLKVGRTWGSLDSYTPEIMLKYAAQINEP*
• ORF Type: complete

Annotations of Ll_transcript_339247

• Blastp: Helicase and polymerase-containing protein TEBICHI from Arabidopsis with 71.89% of identity
• Blastx: Helicase and polymerase-containing protein TEBICHI from Arabidopsis with 71.69% of identity
• Eggnog: DNA polymerase(COG0749)
• Kegg: Link to kegg annotations (AT4G32700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447493.1)
• Pfam: DNA polymerase family A (PF00476.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;