Protein coding transcript 57846

• Transcript: Ll_transcript_336531
• CDS coordinates: 1580-2449 (+)
• Peptide sequence: MIKWLLSTSLMVKAVLVLFLMNISLLGIWPLLIFGGSRVKMVIYYFRNRDRDGFRMGIQILNSSMQQLTGGESLMLYLDLFSESNWNRPTLDGIDFKSISNADNSFLTLKFEEEDIREAVWSCDGDKSPWHDGYNFCFIKKLWNCVKSNILALVDDFYTYGNLVRGCNASFIVLIPKNDCPQGLDEYRPISLIGCLRKIISKLLAGRIKKVIHTVISDCQIAFIKGRYIMDGIVIANEIIDQARKKKDQNCFIFKVDFEKAYDSMDWSFLLYMMERMGFRATWRNYFIP*
• ORF Type: complete

Annotations of Ll_transcript_336531

• Blastp: LINE-1 reverse transcriptase homolog from Nycticebus with 24.54% of identity
• Blastx: LINE-1 retrotransposable element ORF2 protein from Mus with 26.64% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465331.1)
• Pfam: Endonuclease/Exonuclease/phosphatase family (PF03372.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;